PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7528_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 288aa    MW: 31658.8 Da    PI: 8.3407
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7528_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.61.7e-19853147
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         +g+W++eEdell ++v+++G ++W+ I + ++ gR++k+c++rw + 
  cra_locus_7528_iso_1_len_1284_ver_3  8 KGPWSPEEDELLRKLVERHGARNWSIICKSIP-GRSGKSCRLRWCNQ 53
                                         79******************************.***********985 PP

2Myb_DNA-binding60.24.5e-1962104347
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          ++T+eEde++++a+++lG++ W+tIa+ ++ gRt++ +k++w++ 
  cra_locus_7528_iso_1_len_1284_ver_3  62 PFTPEEDEIIIRAHAKLGNK-WATIAKLLN-GRTDNAIKNHWNST 104
                                          89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.548358IPR017930Myb domain
SuperFamilySSF466898.61E-335101IPR009057Homeodomain-like
SMARTSM007174.5E-17756IPR001005SANT/Myb domain
PfamPF002494.6E-19853IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-26961IPR009057Homeodomain-like
CDDcd001675.28E-161052No hitNo description
SMARTSM007172.4E-1659107IPR001005SANT/Myb domain
PROSITE profilePS5129422.21459109IPR017930Myb domain
CDDcd001673.39E-1362105No hitNo description
Gene3DG3DSA:1.10.10.609.0E-2562108IPR009057Homeodomain-like
PfamPF002491.0E-1662104IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MEASDRIKGP WSPEEDELLR KLVERHGARN WSIICKSIPG RSGKSCRLRW CNQLSPEVAH  60
RPFTPEEDEI IIRAHAKLGN KWATIAKLLN GRTDNAIKNH WNSTLKRKFS AMFEGNGVCG  120
EEEERPLQML KRTDSGDVTV TMVSSLRLSP DSTAGSDVSD SAINVPLNWP QAREGQGMQP  180
TLQLQAAESN TSAAISNDPL TALTLSLPGT VSASRSQPSR SSSESIEHVS PATVTGEESG  240
KKKESPSLTP ELLSVMQEMI RKEVRNYFSE LDGVVKNAGL KRIGIPKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-4071093105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-40710957159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-40710957159MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-4071093105C-Myb DNA-Binding Domain
1msf_C1e-4071093105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088207.12e-96PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW17e-76MYB44_ARATH; Transcription factor MYB44
TrEMBLB9HH805e-91B9HH80_POPTR; Uncharacterized protein
STRINGPOPTR_0007s10490.11e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471